General Information

  • ID:  hor005649
  • Uniprot ID:  P35519(1-93)
  • Protein name:  Neurophysin 1
  • Gene name:  NA
  • Organism:  Anser anser anser (Western greylag goose)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Anser anser (species), Anser (genus), Anserinae (subfamily), Anatidae (family), Anseriformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVLDGDVRKCLPCGPRNRGRCFGPRICCGEELGCYLGTPETLRCQEESFLPTPCESGRKPCGGDGASCAAPGICCSSEGCVADPACEREALFA
  • Length:  93(1-93)
  • Propeptide:  AVLDGDVRKCLPCGPRNRGRCFGPRICCGEELGCYLGTPETLRCQEESFLPTPCESGRKPCGGDGASCAAPGICCSSEGCVADPACEREALFA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neurophysin 1 specifically binds oxytocin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-74; 68-86; 75-80
  • Structure ID:  AF-P35519-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P35519-F1.pdbhor005649_AF2.pdbhor005649_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1131724 Formula: C399H639N121O131S14
Absent amino acids: HMW Common amino acids: CG
pI: 4.58 Basic residues: 10
Polar residues: 37 Hydrophobic residues: 23
Hydrophobicity: -18.6 Boman Index: -15370
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.7
Instability Index: 4057.53 Extinction Coefficient cystines: 2365
Absorbance 280nm: 25.71

Literature

  • PubMed ID:  2276874
  • Title:  Complete amino acid sequence of goose VLDV-neurophysin. Traces of a putative gene conversion between promesotocin and provasotocin genes.
  • PubMed ID:  3427215
  • Title:  Gene conversion in avian mesotocin and vasotocin genes: a recurrent mechanism linking two neurohypophysial precursor